PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre06.g278159.t1.1
Common NameCGLD18, CHLREDRAFT_159133, CO
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family CO-like
Protein Properties Length: 411aa    MW: 43503.3 Da    PI: 4.5769
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre06.g278159.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.27.1e-08341538
            zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                         C  +    +  +C++++ llC+dC + +H +      Ht
  Cre06.g278159.t1.1  3 SCVVCAAA-AVVWCQNDKALLCKDCDVRIHTSnavaarHT 41
                        7999*988.*********************6667777776 PP

2CCT64.23.9e-22343387145
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                         Re+++ RY+eKrk+R F K+irY+sRKa+Ae RpR+KGrF+k++e
  Cre06.g278159.t1.1 343 REQRVARYREKRKNRSFAKTIRYASRKAYAEIRPRIKGRFAKKEE 387
                         9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.1E-5145IPR000315B-box-type zinc finger
PfamPF006433.8E-5341IPR000315B-box-type zinc finger
PROSITE profilePS501199.4714184IPR000315B-box-type zinc finger
SMARTSM003364.14684IPR000315B-box-type zinc finger
PfamPF062031.9E-17343385IPR010402CCT domain
PROSITE profilePS5101715.983343385IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0010018Biological Processfar-red light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MSSCVVCAAA AVVWCQNDKA LLCKDCDVRI HTSNAVAARH TRFVPCQGCN KAGAALYCKC  60
DAAHMCEACH SSNPLAATHE TEPVAPLPSV EQGAAPEPQV LNMPCESVAQ SAASPAAWFV  120
DDEKMGTTSF FDAPAVLSPS GSEAVVPVMS APIEDEFAFA AAPATFKEIK DKLEFEALDL  180
DNNWLDMGFD FTDILSDGPS DVGLVPTFDA VDEAADAVAD AIVPTFEEEQ PQLQQQEPLV  240
LAPAPEESAA SRKRAAAEEA AEEPAAKVPA LTHQALLQAQ AAAFQAVPQA SALFFQPQML  300
AALPHLPLLQ QPMMPAAVAP APVPKSGSAA ASAALAAGAN LTREQRVARY REKRKNRSFA  360
KTIRYASRKA YAEIRPRIKG RFAKKEEIEA WKAAHGGDDA IVPEVLDAEC *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.34770.0normal conditions| nutrient deficiency
Function -- GeneRIF ? help Back to Top
  1. effects observed may reflect conserved role for CrCO in the coordination of processes regulated by photoperiod & the circadian clock; data indicate CONSTANS orthologs probably represent ancient regulators of photoperiod-dependent events
    [PMID: 19230666]
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM9400030.0AM940003.1 Chlamydomonas reinhardtii partial mRNA for CONSTANS-like protein (CO gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001698092.10.0B-box zinc finger protein
TrEMBLA8J9360.0A8J936_CHLRE; B-box zinc finger protein
STRINGEDO996770.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP6111112
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24790.27e-21CONSTANS-like 3
Publications ? help Back to Top
  1. Merchant SS, et al.
    The Chlamydomonas genome reveals the evolution of key animal and plant functions.
    Science, 2007. 318(5848): p. 245-50
    [PMID:17932292]
  2. Serrano G, et al.
    Chlamydomonas CONSTANS and the evolution of plant photoperiodic signaling.
    Curr. Biol., 2009. 19(5): p. 359-68
    [PMID:19230666]